PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G183500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 710aa    MW: 78537.9 Da    PI: 5.7144
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G183500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.31.2e-084725091954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yp+ +++  LA+++gL+  qV++WF N R +
  Aqcoe5G183500.1.p 472 FEHflHPYPKDSDKITLARQTGLSRGQVSNWFINARVR 509
                        664459******************************88 PP

2BELL109.61.9e-35336405372
               BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        q+lq+k + Lls+l+eVd+rYk+y++q+q+v++ F+ +ag g++kpYt+lAl++iSrhFrc++dai+ qi
  Aqcoe5G183500.1.p 336 QDLQNKVTELLSMLDEVDRRYKHYYHQMQIVAAYFDGIAGNGASKPYTTLALQTISRHFRCVRDAISRQI 405
                        899*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.9E-43251403IPR006563POX domain
PfamPF075261.5E-43257402IPR006563POX domain
PROSITE profilePS5007111.855450513IPR001356Homeobox domain
CDDcd000867.06E-12453514No hitNo description
SMARTSM003892.7E-8453517IPR001356Homeobox domain
SuperFamilySSF466892.31E-16454520IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-27456519IPR009057Homeodomain-like
PfamPF059201.4E-17470509IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MATYYSSSCN QDVMPETCQK DLLRAPYPEG QVVSSNMMMY LNQSTPSVSY SDSVPGDYQQ  60
HNCGELPAAG ASHSSPLRQG NLSDLIGSNI REAPYDLWRD GVNEMSFMQH MSDSVNTQSM  120
SKQIDSRNDL VHGSVTDDSQ MGLSPQMEIL HRGPSLPGQG LSLSLSTQIP TAVPVSLLHN  180
RSNLGLSSFF SSYTSTVGDA GNGASSCRDD EIAHSGHSGH IGYFTQRFPR KNQNVVKGET  240
GLNYLPSNKL SGLSSIIPNS KYLKVAQQLL DEIIDVRKAP QQDSEKQQSF EFGLKISKDN  300
DRPKEDCDLS PGTRKVQNNE VSNTNAAGEH SPASSQDLQN KVTELLSMLD EVDRRYKHYY  360
HQMQIVAAYF DGIAGNGASK PYTTLALQTI SRHFRCVRDA ISRQIKEIRS SLGDEDTVGN  420
TKEGGISRLR LVEQKLRQHR ALQQLGMMQQ HAWRPQRGLP ETSVTILRAW LFEHFLHPYP  480
KDSDKITLAR QTGLSRGQVS NWFINARVRL WKPMIEDMYK EEIGDSEMEF NSSSDNTPIP  540
ASHNTVSEDI NINSAQSKTN LTCDVKMSGN ASGSCFQGEG HDDINTHYAG MNLIGEPNST  600
NCSLSQNKLF QSDENADGRF MAASNAYQLA ELEMFGSQGG ISLTLGLQHF DGAISDTTHQ  660
NFVTMPGDDM YNAQTSSMEP NNGDTNCMDP DNHQQYRFGT SHLFHDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A3e-16459516158Homeobox protein Meis1
4xrs_B3e-16459516158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010254698.10.0PREDICTED: BEL1-like homeodomain protein 6
TrEMBLF6I1B00.0F6I1B0_VITVI; Putative uncharacterized protein
STRINGVIT_03s0038g00050.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-115BEL1-like homeodomain 7